PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA43G00006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 690aa    MW: 75360.6 Da    PI: 7.2448
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA43G00006genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3772.1e-24161262199
                 EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                 f+k+lt sd++++g +++p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l++
  AA43G00006 161 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSQPRPSQELVARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRL 257
                 99****************************955566788*************************************************..3489999** PP

                 EEE-S CS
          B3  95 kvfrk 99 
                 +v+r+
  AA43G00006 258 GVRRA 262
                 *9986 PP

2Auxin_resp114.31.1e-37287368182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 + ha+st+s+F+++YnP+a++s+F+++++k++k+++ ++++GmRfk ++e+ed+serr+ G+++g+ dldp+rWp+SkWr+L
  AA43G00006 287 VTHAISTQSMFSIYYNPKATWSNFIIPASKFLKSVDYPFCIGMRFKTRVESEDASERRCPGIITGIGDLDPLRWPGSKWRCL 368
                 679******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.45E-42152267IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-39155265IPR015300DNA-binding pseudobarrel domain
CDDcd100174.73E-22159261No hitNo description
PfamPF023622.3E-22161262IPR003340B3 DNA binding domain
SMARTSM010191.4E-22161263IPR003340B3 DNA binding domain
PROSITE profilePS5086313.296161263IPR003340B3 DNA binding domain
PfamPF065073.3E-32288368IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MGGLIDLNVM ETEDDETPSS PSGSLSPSSS SASAISGSVS SLSNSAGVCL ELWHACAGPL  60
ISLPKRGSLV MYFPQGHLEQ APDFSAAIYG LPPHVFCRVL DVKLHAETAT DDVYAQVSLL  120
PESELTLLEI DQRLREGGNL DIDGGEDDYE VLKRSSTPHM FCKTLTASDT STHGGFSVPR  180
RAAEDCFPPL DYSQPRPSQE LVARDLHGLE WRFRHIYRGQ PRRHLLTTGW SAFVNKKKLV  240
SGDAVLFLRG DDGKLRLGVR RAAQIKGTSA FSSQYIQNMN HKNFAEVTHA ISTQSMFSIY  300
YNPKATWSNF IIPASKFLKS VDYPFCIGMR FKTRVESEDA SERRCPGIIT GIGDLDPLRW  360
PGSKWRCLMV RWDDIEANGH QQRVSPWEIE PSGSVSNSVS FITTGPKRSR IGFSSVKPDI  420
PASEAVHTSD FGESLRFQRV LQGQEIFPGF NNTSASDCGG GGSRRGRFMP HKETDFGYSF  480
GFHKVLQGQE IFPGFNNTSA SDCGGGGSRR GRFMPHKETD FGYSFGFHKV LQGQETIPDF  540
SSYVNGGNSG ISISDGHQML SQRNIWSGPF QNFSTRVLPP SAVHLSSPSS VLIPNSKHGV  600
SSFNPMLPIS GSTEAHGGSD TCKSRCRLFG FPLTEETHVG AGVASATMEK SGKVVVPEGQ  660
IGNVLKSAAV HHSQGRDIYA MRDMLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1094539916362Auxin response factor 1
4ldy_B1e-1094539916362Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410539.10.0hypothetical protein EUTSA_v10016394mg
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLV4MA800.0V4MA80_EUTSA; Auxin response factor
STRINGAT2G33860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein